PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678443619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 324aa    MW: 37451.6 Da    PI: 5.0877
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678443619genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-092192522255
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +yp++ ++++L++ +gL+++q+ +WF N+R ++
  678443619 219 WPYPTEVDKKRLSEMTGLDQKQINNWFINQRKRH 252
                48*****************************885 PP

2ELK41.52.7e-14172193122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++L+rKYsgyL++Lk+EF+
  678443619 172 ELKDMLMRKYSGYLSTLKEEFM 193
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.3E-143781IPR005540KNOX1
PfamPF037903.1E-163979IPR005540KNOX1
SMARTSM012563.7E-1284151IPR005541KNOX2
PfamPF037915.7E-11115150IPR005541KNOX2
PROSITE profilePS5121311.366172192IPR005539ELK domain
SMARTSM011886.4E-8172193IPR005539ELK domain
PfamPF037894.7E-11172193IPR005539ELK domain
PROSITE profilePS5007112.471192255IPR001356Homeobox domain
SuperFamilySSF466894.28E-17194259IPR009057Homeodomain-like
SMARTSM003897.0E-13194259IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-25197256IPR009057Homeodomain-like
CDDcd000867.06E-11204256No hitNo description
PfamPF059208.7E-16212251IPR008422Homeobox KN domain
PROSITE patternPS000270230253IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEEELLHGFG FFDPGEEIPR FDDHLVQLEE EDQRIRDSIK SRIASHPLYP ALLSSYLLSQ  60
KVGAPPEIAS LLEEISKEIH VRGKPTEIGA DPQLDDFMFF DMLFLLFFCL WLYKESYTGV  120
LNRYTQELSK PFDEATSYLS SIESQLSALC IQTLPSPAPG EEGSKGGGSE AELKDMLMRK  180
YSGYLSTLKE EFMKKRKKGK LPKDATSALM DWWNANNAWP YPTEVDKKRL SEMTGLDQKQ  240
INNWFINQRK RHWRPSEEIK FALMEAGGSE NEEEDDALIT SHNPHYLIWC FCNKESYLYG  300
KNKHLFSVMA MDLSSVEKKK RTSW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187196LKEEFMKKRK
2193197KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434276.18e-91PREDICTED: homeobox protein knotted-1-like 1
SwissprotP466401e-70KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBLA0A0D2STR69e-91A0A0D2STR6_G
STRINGPOPTR_0013s01000.14e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.13e-50KNOTTED-like from Arabidopsis thaliana 2